PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A11G0406
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ZF-HD
Protein Properties Length: 297aa    MW: 33420.5 Da    PI: 9.3128
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A11G0406genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.75.6e-3392147460
  ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                  +rY+eClkNh as+Ggh+vDGCgEfmps ge+gt++alkCaAC+CHRnFHR+e + e
  Gh_A11G0406  92 IRYRECLKNHVASMGGHVVDGCGEFMPS-GEDGTQEALKCAACECHRNFHRKEIDGE 147
                  79*************************9.999********************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047701.2E-3092144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2192145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.8E-3093144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.1994143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.2E-29219295IPR009057Homeodomain-like
SuperFamilySSF466891.33E-19222294IPR009057Homeodomain-like
TIGRFAMsTIGR015656.5E-27233290IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEVKGQDKQM GMPSSFSRNN KLNQADSSLK ISSSSAPINQ SRTLDQYNES NPSQHQIDNP  60
RSNPDHDRNP VSAPIPTVAA PTSTTISSTP LIRYRECLKN HVASMGGHVV DGCGEFMPSG  120
EDGTQEALKC AACECHRNFH RKEIDGETQY PATRCCFTYK NNERRGTVHP QQPTPLRQQR  180
FSLGFSNSPC LPIAPAAMMN FGGGPTESSS EELNMFHSNE AGGRQPSYPQ SSKKRFRTKF  240
SRDQKDKMME FAEKLGWRIQ KQDEPEVQQF CAQVGVKRQV FKVWMHNSKQ AMKKKQM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-232322891673ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012489135.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotQ9ZPW76e-66ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D2S7740.0A0A0D2S774_G
STRINGPOPTR_0005s12420.14e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.12e-65homeobox protein 24